PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim03g043830.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 175aa    MW: 20528.2 Da    PI: 5.0566
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim03g043830.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.83.1e-1051110463
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          k+ rr ++NR++A+rsR RK ++i+ L++++k Le+    L  ++e+ k++ +kl+ e+
  Sopim03g043830.0.1  51 MKKLRRTISNRLSAQRSRMRKTEYIDLLKKEAKDLEERIAFLGRKIENDKDNNKKLQLEN 110
                         6999***************************************************99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.2E-548119IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.15150113IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.17E-951106No hitNo description
PfamPF001701.0E-951110IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-1052107No hitNo description
CDDcd147023.47E-75397No hitNo description
PROSITE patternPS0003605570IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MNEKRIKSDE PHLSLPLKTP IEYESVNRIP SLEEALNSEI KHGQVDPNMN MKKLRRTISN  60
RLSAQRSRMR KTEYIDLLKK EAKDLEERIA FLGRKIENDK DNNKKLQLEN QMLQLQLDSI  120
TNKSNLLAVQ NEELKAELKR LKEPEDEEDE EYIDIDQYLN FDNMNFSPSR NDGI*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755151e-87HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015068619.11e-100PREDICTED: transcription factor HY5-like
TrEMBLK4BG031e-121K4BG03_SOLLC; Uncharacterized protein
STRINGSolyc03g043830.1.11e-121(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA76151929
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07160.19e-08bZIP family protein